PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.F48KW
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 557aa    MW: 63039.8 Da    PI: 4.3157
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.F48KWgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.6e-53241502128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  +pGfrFhPtdeelv++yLk+k+ gkkl+l +vi e+d+yk++P++Lp+   +++++++w+fF++rd+ky++g r+nrat++gyWkatgkd++v++ ++
  Aradu.F48KW  24 MPGFRFHPTDEELVMYYLKRKICGKKLKL-DVILETDVYKWDPEELPEisVLRTGDRQWFFFTHRDRKYPNGARSNRATRQGYWKATGKDRNVTC-NS 119
                  69***************************.99**************94447788999**************************************.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vg+kktLvfy+grap+ge+tdWvmhey++
  Aradu.F48KW 120 RSVGVKKTLVFYRGRAPNGERTDWVMHEYTM 150
                  9****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-5820173IPR003441NAC domain
PROSITE profilePS5100554.05723173IPR003441NAC domain
PfamPF023651.3E-2725149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
GFFGLSMGAE AGATECFSKA MASMPGFRFH PTDEELVMYY LKRKICGKKL KLDVILETDV  60
YKWDPEELPE ISVLRTGDRQ WFFFTHRDRK YPNGARSNRA TRQGYWKATG KDRNVTCNSR  120
SVGVKKTLVF YRGRAPNGER TDWVMHEYTM DEEELNRCQD IKDYFALYKL YKKSGPGPKN  180
GEQYGAPFKE EEWADDECVD FNINSADREE VNTVPVNDQL PPLADDEVTD MINQILDNEL  240
ALDQQFGDGL EFPQVVAEET QSTVVDQFSE AVTDPEYNDI YHSTSQHYDV QNVNFNQSVA  300
SHLHAPEGSE VISTANIQVE DYNFQEDDFL EINDLNGSEL TIPNMETPVE NLQFEDGLCE  360
LDLFQDAEMF LRDLGPINEE TIPHSYMNNA AGSNIENQNY HLLPNPEDAT QNVHEFWMHD  420
ERNTSSLFEG FDDSLSQQNP GAVSTEGYDN QSSIAEDVAT SRFSSALWSF VESIPTTPAS  480
AAENALVNRA LNRMSSFSRV KINIKPTNTA AGKDTATTKR VGRKGFSFLF FPIIIALCAF  540
LWVSLGTFRL LGRCIAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-492515017140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015942523.10.0PREDICTED: NAC domain-containing protein 16-like
TrEMBLI1LDA80.0I1LDA8_SOYBN; NAC transcription factor
STRINGGLYMA10G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34180.11e-133NAC domain containing protein 16